GET /api/protein/UniProt/Q93DY4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q93DY4",
"id": "MAMT_MAGGM",
"source_organism": {
"taxId": "431944",
"scientificName": "Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)",
"fullName": "Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)"
},
"name": "Magnetosome protein MamT",
"description": [
"May play a role in magnetite crystal maturation (Probable). May transfer electrons to balance the Fe(2+)-Fe(3+) ratio during magnetite formation (Probable)"
],
"length": 174,
"sequence": "MGTPGGGRRWMTLISITLLMVVGLGLYWDELSLSAGISPATSPRRAEGLLLGRLPLPMEPSILSPLEHLIEPPLQYKLMTIRHIPPVMPGTGMPHPYVGDCIQCHLMVGGPAAGSQFKTPYGAVLENLSRVRKLGPPILPTTRQPHPPAGRCIKCHDIVVKVPVEKKSGIKWLL",
"proteome": "UP000018922",
"gene": "mamT",
"go_terms": null,
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b37fbc67fbbcf061a0f232a0df0f1e0206ba704a",
"counters": {
"domain_architectures": 40,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40
}
}
}