General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q93DY4",
        "id": "MAMT_MAGGM",
        "source_organism": {
            "taxId": "431944",
            "scientificName": "Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)",
            "fullName": "Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)"
        },
        "name": "Magnetosome protein MamT",
        "description": [
            "May play a role in magnetite crystal maturation (Probable). May transfer electrons to balance the Fe(2+)-Fe(3+) ratio during magnetite formation (Probable)"
        ],
        "length": 174,
        "sequence": "MGTPGGGRRWMTLISITLLMVVGLGLYWDELSLSAGISPATSPRRAEGLLLGRLPLPMEPSILSPLEHLIEPPLQYKLMTIRHIPPVMPGTGMPHPYVGDCIQCHLMVGGPAAGSQFKTPYGAVLENLSRVRKLGPPILPTTRQPHPPAGRCIKCHDIVVKVPVEKKSGIKWLL",
        "proteome": "UP000018922",
        "gene": "mamT",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b37fbc67fbbcf061a0f232a0df0f1e0206ba704a",
        "counters": {
            "domain_architectures": 40,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 40
        }
    }
}