"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q93DY4"	"{'domain_architectures': 40, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 40}"	"['May play a role in magnetite crystal maturation (Probable). May transfer electrons to balance the Fe(2+)-Fe(3+) ratio during magnetite formation (Probable)']"	"mamT"	""	"MAMT_MAGGM"	"b37fbc67fbbcf061a0f232a0df0f1e0206ba704a"	True	False	False	174	"Magnetosome protein MamT"	3	"UP000018922"	"MGTPGGGRRWMTLISITLLMVVGLGLYWDELSLSAGISPATSPRRAEGLLLGRLPLPMEPSILSPLEHLIEPPLQYKLMTIRHIPPVMPGTGMPHPYVGDCIQCHLMVGGPAAGSQFKTPYGAVLENLSRVRKLGPPILPTTRQPHPPAGRCIKCHDIVVKVPVEKKSGIKWLL"	"reviewed"	"{'taxId': '431944', 'scientificName': 'Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)', 'fullName': 'Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1)'}"