GET /api/protein/UniProt/Q90ZE4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q90ZE4",
"id": "PSN2_DANRE",
"source_organism": {
"taxId": "7955",
"scientificName": "Danio rerio",
"fullName": "Danio rerio (Zebrafish)"
},
"name": "Presenilin-2",
"description": [
"Catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (By similarity). May play a more prominent role in Notch signaling (PubMed:19563801)"
],
"length": 441,
"sequence": "MNTSDSEEDSYNERSALVQSESPTVPSYNQDNAMSLPQDTDSKRSGAVRSRSASGSGDAGPVDRERADTPDGEEEELTLKYGAKHVIMLFIPVTLCMVVVVATIKSVSFYTEKSGQRLIYTPFEEDPNSVGQRLLNSVLNTLVMISVIVFMTIILVLLYKYRCYKFIHGWLILSSLMLLFWFSFMYLGEVFKTYNVAMDYPTLLMIIWNFGVVGMICIHWKGPLRLQQAYLIVISALMALIFIKYLPEWSAWVILGAISIYDLIAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWMVGMADSNNPDSAGERRRSGGGVRTQEGVESEHDAPQAGRRQYSAEEDLEEDRGVKLGLGDFIFYSVLVGKAAATGGDWNTTLACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFSTDNLVRPFMDSLAAHQYYI",
"proteome": "UP000000437",
"gene": "psen2",
"go_terms": [
{
"identifier": "GO:0042500",
"name": "aspartic endopeptidase activity, intramembrane cleaving",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016485",
"name": "protein processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "08a79b6bf61fe701e9de73d7b1fa8e71bf2e01ee",
"counters": {
"domain_architectures": 1175,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1175
}
}
}