GET /api/protein/UniProt/Q90ZE4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q90ZE4",
        "id": "PSN2_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Presenilin-2",
        "description": [
            "Catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (By similarity). May play a more prominent role in Notch signaling (PubMed:19563801)"
        ],
        "length": 441,
        "sequence": "MNTSDSEEDSYNERSALVQSESPTVPSYNQDNAMSLPQDTDSKRSGAVRSRSASGSGDAGPVDRERADTPDGEEEELTLKYGAKHVIMLFIPVTLCMVVVVATIKSVSFYTEKSGQRLIYTPFEEDPNSVGQRLLNSVLNTLVMISVIVFMTIILVLLYKYRCYKFIHGWLILSSLMLLFWFSFMYLGEVFKTYNVAMDYPTLLMIIWNFGVVGMICIHWKGPLRLQQAYLIVISALMALIFIKYLPEWSAWVILGAISIYDLIAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWMVGMADSNNPDSAGERRRSGGGVRTQEGVESEHDAPQAGRRQYSAEEDLEEDRGVKLGLGDFIFYSVLVGKAAATGGDWNTTLACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFSTDNLVRPFMDSLAAHQYYI",
        "proteome": "UP000000437",
        "gene": "psen2",
        "go_terms": [
            {
                "identifier": "GO:0042500",
                "name": "aspartic endopeptidase activity, intramembrane cleaving",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "08a79b6bf61fe701e9de73d7b1fa8e71bf2e01ee",
        "counters": {
            "domain_architectures": 1175,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1175
        }
    }
}