General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8WSR2",
        "id": "DHSD2_ASCSU",
        "source_organism": {
            "taxId": "6253",
            "scientificName": "Ascaris suum",
            "fullName": "Ascaris suum (Pig roundworm)"
        },
        "name": "Succinate dehydrogenase [ubiquinone] cytochrome b small subunit 2",
        "description": [
            "Membrane-bound small subunit (CybS) of the mitochondrial electron transport chain complex II, which together with the membrane-bound large subunit (CybL), anchor the catalytic subunits to the inner mitochondria membrane (PubMed:12742584, PubMed:17933581, PubMed:8435436). During the free-living egg-larvae stages, which occur in an aerobic environment, complex II acts as a succinate dehydrogenase by transferring electrons from succinate to ubiquinone (PubMed:12742584, PubMed:17933581, PubMed:8435436)"
        ],
        "length": 141,
        "sequence": "MSLIRCTTSKALKFRQLLKMAARTSVTTPVSREPFSIEDHSLHFKIERYWAAGMIPLIPTAYFIHTPAMDAVLTVAIVLHVHWGIAGVVSDYARPFVIGDTLARVARASVYIITVILLASLLHFNNSDVGLTKAFEMVWSL",
        "proteome": null,
        "gene": "SDHD2",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005740",
                "name": "mitochondrial envelope",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91b5201bad852a470a148f55f5a5a0c56a689277",
        "counters": {
            "domain_architectures": 3947,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3947
        }
    }
}