"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8WSR2"	"{'domain_architectures': 3947, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3947}"	"['Membrane-bound small subunit (CybS) of the mitochondrial electron transport chain complex II, which together with the membrane-bound large subunit (CybL), anchor the catalytic subunits to the inner mitochondria membrane (PubMed:12742584, PubMed:17933581, PubMed:8435436). During the free-living egg-larvae stages, which occur in an aerobic environment, complex II acts as a succinate dehydrogenase by transferring electrons from succinate to ubiquinone (PubMed:12742584, PubMed:17933581, PubMed:8435436)']"	"SDHD2"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005740', 'name': 'mitochondrial envelope', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"DHSD2_ASCSU"	"91b5201bad852a470a148f55f5a5a0c56a689277"	True	False	False	141	"Succinate dehydrogenase [ubiquinone] cytochrome b small subunit 2"	1	""	"MSLIRCTTSKALKFRQLLKMAARTSVTTPVSREPFSIEDHSLHFKIERYWAAGMIPLIPTAYFIHTPAMDAVLTVAIVLHVHWGIAGVVSDYARPFVIGDTLARVARASVYIITVILLASLLHFNNSDVGLTKAFEMVWSL"	"reviewed"	"{'taxId': '6253', 'scientificName': 'Ascaris suum', 'fullName': 'Ascaris suum (Pig roundworm)'}"