HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8UUH9",
"id": "PA2B9_LATCO",
"source_organism": {
"taxId": "8628",
"scientificName": "Laticauda colubrina",
"fullName": "Laticauda colubrina (Yellow-lipped sea krait)"
},
"name": "Basic phospholipase A2 PC9",
"description": [
"Snake venom phospholipase A2 (PLA2) that inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (By similarity)"
],
"length": 155,
"sequence": "MYPAHLLVLLAVCVSLLGASAISPRPLNLIQFSQLIQCANKGKRPTLHYMDYGCYCGKGGSGTPVDALDRCCKTHDDCYGQAGKKGCIPFVTLYNFGCFPGAPQCGKGNTCQRFVCACDLKAALCFAKSPYNNNNYNIDTKKKCQTLIYARLQTQ",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004623",
"name": "A2-type glycerophospholipase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006644",
"name": "phospholipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050482",
"name": "arachidonate secretion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016042",
"name": "lipid catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bd0c304bac6c9e2ec8f8d5ae78d4c8944ec3a50b",
"counters": {
"domain_architectures": 9115,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prosite": 2,
"prints": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9115
}
}
}