"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8UUH9"	"{'domain_architectures': 9115, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 2, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9115}"	"['Snake venom phospholipase A2 (PLA2) that inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (By similarity)']"	""	"[{'identifier': 'GO:0004623', 'name': 'A2-type glycerophospholipase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006644', 'name': 'phospholipid metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0050482', 'name': 'arachidonate secretion', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016042', 'name': 'lipid catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"PA2B9_LATCO"	"bd0c304bac6c9e2ec8f8d5ae78d4c8944ec3a50b"	True	False	False	155	"Basic phospholipase A2 PC9"	3	""	"MYPAHLLVLLAVCVSLLGASAISPRPLNLIQFSQLIQCANKGKRPTLHYMDYGCYCGKGGSGTPVDALDRCCKTHDDCYGQAGKKGCIPFVTLYNFGCFPGAPQCGKGNTCQRFVCACDLKAALCFAKSPYNNNNYNIDTKKKCQTLIYARLQTQ"	"reviewed"	"{'taxId': '8628', 'scientificName': 'Laticauda colubrina', 'fullName': 'Laticauda colubrina (Yellow-lipped sea krait)'}"
