HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8R4R6",
"id": "NUP35_MOUSE",
"source_organism": {
"taxId": "10090",
"scientificName": "Mus musculus",
"fullName": "Mus musculus (Mouse)"
},
"name": "Nucleoporin NUP35",
"description": [
"Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity)"
],
"length": 325,
"sequence": "MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW",
"proteome": "UP000000589",
"gene": "Nup35",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0017056",
"name": "structural constituent of nuclear pore",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006913",
"name": "nucleocytoplasmic transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0031965",
"name": "nuclear membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "06a7ea84e37b94183e5f3785760c5b934c37997c",
"counters": {
"domain_architectures": 3331,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 1,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3331
}
}
}