"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8R4R6"	"{'domain_architectures': 3331, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3331}"	"['Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity)']"	"Nup35"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0017056', 'name': 'structural constituent of nuclear pore', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006913', 'name': 'nucleocytoplasmic transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0031965', 'name': 'nuclear membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"NUP35_MOUSE"	"06a7ea84e37b94183e5f3785760c5b934c37997c"	True	False	False	325	"Nucleoporin NUP35"	1	"UP000000589"	"MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"
