GET /api/protein/UniProt/Q8LK80/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8LK80",
        "id": "Q8LK80_ORYSJ",
        "source_organism": {
            "taxId": "39947",
            "scientificName": "Oryza sativa subsp. japonica",
            "fullName": "Oryza sativa subsp. japonica (Rice)"
        },
        "name": "Ferritin",
        "description": [
            "Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation",
            "Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation"
        ],
        "length": 251,
        "sequence": "MLPPRVAPAAAAAAPTYLAAAASTPASVWLPVPRGAGPGAVCRAAGKGKEVLSGVVFQPFEELKGELSLVPQAKDQSLARQKFVDECEAAINEQINVEYNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEKLVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFDQKLLEEEA",
        "proteome": null,
        "gene": "Fer1",
        "go_terms": [
            {
                "identifier": "GO:0008199",
                "name": "ferric iron binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006826",
                "name": "iron ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006879",
                "name": "intracellular iron ion homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cec8b804a2b695828936e90d7cf5ad612fb951b2",
        "counters": {
            "domain_architectures": 62699,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 62699
        }
    }
}