HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8LK80",
"id": "Q8LK80_ORYSJ",
"source_organism": {
"taxId": "39947",
"scientificName": "Oryza sativa subsp. japonica",
"fullName": "Oryza sativa subsp. japonica (Rice)"
},
"name": "Ferritin",
"description": [
"Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation",
"Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation"
],
"length": 251,
"sequence": "MLPPRVAPAAAAAAPTYLAAAASTPASVWLPVPRGAGPGAVCRAAGKGKEVLSGVVFQPFEELKGELSLVPQAKDQSLARQKFVDECEAAINEQINVEYNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEKLVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFDQKLLEEEA",
"proteome": null,
"gene": "Fer1",
"go_terms": [
{
"identifier": "GO:0008199",
"name": "ferric iron binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006826",
"name": "iron ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006879",
"name": "intracellular iron ion homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cec8b804a2b695828936e90d7cf5ad612fb951b2",
"counters": {
"domain_architectures": 62699,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 62699
}
}
}