"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8LK80"	"{'domain_architectures': 62699, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 62699}"	"['Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation', 'Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation']"	"Fer1"	"[{'identifier': 'GO:0008199', 'name': 'ferric iron binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006826', 'name': 'iron ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006879', 'name': 'intracellular iron ion homeostasis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q8LK80_ORYSJ"	"cec8b804a2b695828936e90d7cf5ad612fb951b2"	True	False	False	251	"Ferritin"	2	""	"MLPPRVAPAAAAAAPTYLAAAASTPASVWLPVPRGAGPGAVCRAAGKGKEVLSGVVFQPFEELKGELSLVPQAKDQSLARQKFVDECEAAINEQINVEYNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEKLVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFDQKLLEEEA"	"unreviewed"	"{'taxId': '39947', 'scientificName': 'Oryza sativa subsp. japonica', 'fullName': 'Oryza sativa subsp. japonica (Rice)'}"
