GET /api/protein/UniProt/Q8IE14/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8IE14",
        "id": "SEC11_PLAF7",
        "source_organism": {
            "taxId": "36329",
            "scientificName": "Plasmodium falciparum (isolate 3D7)",
            "fullName": "Plasmodium falciparum (isolate 3D7)"
        },
        "name": "Signal peptidase complex catalytic subunit SEC11",
        "description": [
            "Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:18054093, PubMed:30127496). Specifically cleaves N-terminal signal peptides that contain a hydrophobic alpha-helix (h-region) shorter than 18-20 amino acids (By similarity)"
        ],
        "length": 184,
        "sequence": "MDFIKEQYNSLVLDLRKTFRNKRDGLSHILNVICLLLNALMIWKLLVVFTGCESPVVVVLSGSMEPGYYRGDTLALYHPPKIHAGDVVVYQINGRDIPIVHRILSLHTSKDNKFHLLSKGDNNNIDDRGLYDPHQYWLENEHVLGLSVGYTPYIGILTIWINEYPVVKWAIVSIMLIMILMGYE",
        "proteome": "UP000001450",
        "gene": "SEC11",
        "go_terms": [
            {
                "identifier": "GO:0004252",
                "name": "serine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006465",
                "name": "signal peptide processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008233",
                "name": "peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "21a303415f586161a7ae3f861798b3e824195375",
        "counters": {
            "domain_architectures": 27568,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27568
        }
    }
}