HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8BHD0",
"id": "RB39A_MOUSE",
"source_organism": {
"taxId": "10090",
"scientificName": "Mus musculus",
"fullName": "Mus musculus (Mouse)"
},
"name": "Ras-related protein Rab-39A",
"description": [
"The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). RAB39A regulates autophagosome-lysosome fusion via recruitment of the HOPS endosomal tethering complex onto lysosomes; this process involves lysosomal RAB39A and autophagosomal RAB2A recruitment of HOPS subcomplexes VPS41-VPS16-VPS18-VPS33A and VPS39-VPS11, respectively, which assemble into a functional complex to mediate membrane tethering and SNAREs-driven membrane fusion (By similarity). Also negatively regulates lipopolysaccharide (LPS)-induced autophagosome formation in macrophages, possibly by implicating PI3K (By similarity). Promotes the delivery of MHC-I molecules from the ER to phagosomes and the generation of peptide-loaded MHC-I complexes in phagosomes, thus enhancing antigen cross-presentation by dendritic cells (PubMed:31821587). Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes (By similarity). May be involved in multiple neurite formation (PubMed:23624502)"
],
"length": 217,
"sequence": "METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC",
"proteome": "UP000000589",
"gene": "Rab39a",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032482",
"name": "Rab protein signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
"counters": {
"domain_architectures": 273930,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"smart": 4,
"cathgene3d": 1,
"ncbifam": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 273930
}
}
}
