"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8BHD0"	"{'domain_architectures': 273930, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 3, 'smart': 4, 'cathgene3d': 1, 'ncbifam': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 273930}"	"['The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). RAB39A regulates autophagosome-lysosome fusion via recruitment of the HOPS endosomal tethering complex onto lysosomes; this process involves lysosomal RAB39A and autophagosomal RAB2A recruitment of HOPS subcomplexes VPS41-VPS16-VPS18-VPS33A and VPS39-VPS11, respectively, which assemble into a functional complex to mediate membrane tethering and SNAREs-driven membrane fusion (By similarity). Also negatively regulates lipopolysaccharide (LPS)-induced autophagosome formation in macrophages, possibly by implicating PI3K (By similarity). Promotes the delivery of MHC-I molecules from the ER to phagosomes and the generation of peptide-loaded MHC-I complexes in phagosomes, thus enhancing antigen cross-presentation by dendritic cells (PubMed:31821587). Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes (By similarity). May be involved in multiple neurite formation (PubMed:23624502)']"	"Rab39a"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032482', 'name': 'Rab protein signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RB39A_MOUSE"	"31aa1b32c82271990f81b4779ae58d1cb9b14b00"	True	False	False	217	"Ras-related protein Rab-39A"	1	"UP000000589"	"METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"