General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q87LA3",
        "id": "SSB_VIBPA",
        "source_organism": {
            "taxId": "223926",
            "scientificName": "Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)",
            "fullName": "Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)"
        },
        "name": "Single-stranded DNA-binding protein",
        "description": [
            "Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism"
        ],
        "length": 176,
        "sequence": "MASRGINKVILVGNLGNDPEIRYMPNGGAVANITIATSESWRDKATGEQREKTEWHRVVLFGKLAEVAGEYLRKGSQVYVEGQLQTRKWQDQSGQDRYSTEVVVQGFNGVMQMLGGRAQGGAPAMGGQQQQQGGWGQPQQPAQQQYNAPQQQQQAPQQPQQQYNEPPMDFDDDIPF",
        "proteome": null,
        "gene": "ssb",
        "go_terms": [
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f1fb2be8363e3a291867f69be613915a57077a1b",
        "counters": {
            "domain_architectures": 57966,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 57966
        }
    }
}