"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q87LA3"	"{'domain_architectures': 57966, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'cdd': 1, 'ncbifam': 2, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 57966}"	"['Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism']"	"ssb"	"[{'identifier': 'GO:0003697', 'name': 'single-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SSB_VIBPA"	"f1fb2be8363e3a291867f69be613915a57077a1b"	True	False	False	176	"Single-stranded DNA-binding protein"	3	""	"MASRGINKVILVGNLGNDPEIRYMPNGGAVANITIATSESWRDKATGEQREKTEWHRVVLFGKLAEVAGEYLRKGSQVYVEGQLQTRKWQDQSGQDRYSTEVVVQGFNGVMQMLGGRAQGGAPAMGGQQQQQGGWGQPQQPAQQQYNAPQQQQQAPQQPQQQYNEPPMDFDDDIPF"	"reviewed"	"{'taxId': '223926', 'scientificName': 'Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)', 'fullName': 'Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)'}"