HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q84Y01",
"id": "ITPK1_MAIZE",
"source_organism": {
"taxId": "4577",
"scientificName": "Zea mays",
"fullName": "Zea mays (Maize)"
},
"name": "Inositol-tetrakisphosphate 1-kinase 1",
"description": [
"Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3 and participates in phytic acid biosynthesis in developing seeds (PubMed:12586875, PubMed:32123645). Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not (PubMed:12586875). Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway (PubMed:12586875). Also able to phosphorylate Ins(3,5,6)P3 but not Ins(1,4,5)P3, Ins(2,4,5)P3, Ins(1,3,4,6)P4 nor Ins(1,3,5,6)P4. Has higher specific activity on Ins(3,4,5,6)P4 than Ins(1,3,4)P3 and Ins(3,5,6)P3 (PubMed:12586875). Can also could use Ins(1,2,5,6)P4 as a substrate (PubMed:12586875). Able to add a beta-phosphate to the 3 positions of Ins(1,2,3,4,5)P5 and to add beta-phosphate to InsP6 to yield 5-InsP7, thus exhibiting InsP6 kinase activity (PubMed:35635723). Also has Ins(1,3,4,5,6)P5 phosphatase activity (PubMed:35635723)"
],
"length": 342,
"sequence": "MASDAAAEPSSGVTHPPRYVIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQLVAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVYDAAALADFGLLAALRFPLIAKPLVADGTAKSHKMSLVYHREGLGKLRPPLVLQEFVNHGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSFSQVSNLPTERTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDINYFPGYAKMPGYETVLTDFFWEMVHKDGVGNQQEEKGANHVVVK",
"proteome": "UP000007305",
"gene": "ITPK1",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047325",
"name": "inositol-3,4,5,6-tetrakisphosphate 1-kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0052725",
"name": "inositol-1,3,4-trisphosphate 6-kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0052726",
"name": "inositol-1,3,4-trisphosphate 5-kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032957",
"name": "inositol trisphosphate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4698f712b3c343efaf6f66851705ac985cb8c2ed",
"counters": {
"domain_architectures": 4246,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 5,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4246
}
}
}
