"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q84Y01"	"{'domain_architectures': 4246, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 5, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4246}"	"['Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3 and participates in phytic acid biosynthesis in developing seeds (PubMed:12586875, PubMed:32123645). Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not (PubMed:12586875). Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway (PubMed:12586875). Also able to phosphorylate Ins(3,5,6)P3 but not Ins(1,4,5)P3, Ins(2,4,5)P3, Ins(1,3,4,6)P4 nor Ins(1,3,5,6)P4. Has higher specific activity on Ins(3,4,5,6)P4 than Ins(1,3,4)P3 and Ins(3,5,6)P3 (PubMed:12586875). Can also could use Ins(1,2,5,6)P4 as a substrate (PubMed:12586875). Able to add a beta-phosphate to the 3 positions of Ins(1,2,3,4,5)P5 and to add beta-phosphate to InsP6 to yield 5-InsP7, thus exhibiting InsP6 kinase activity (PubMed:35635723). Also has Ins(1,3,4,5,6)P5 phosphatase activity (PubMed:35635723)']"	"ITPK1"	"[{'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0047325', 'name': 'inositol-3,4,5,6-tetrakisphosphate 1-kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0052725', 'name': 'inositol-1,3,4-trisphosphate 6-kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0052726', 'name': 'inositol-1,3,4-trisphosphate 5-kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032957', 'name': 'inositol trisphosphate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"ITPK1_MAIZE"	"4698f712b3c343efaf6f66851705ac985cb8c2ed"	True	False	False	342	"Inositol-tetrakisphosphate 1-kinase 1"	1	"UP000007305"	"MASDAAAEPSSGVTHPPRYVIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQLVAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVYDAAALADFGLLAALRFPLIAKPLVADGTAKSHKMSLVYHREGLGKLRPPLVLQEFVNHGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSFSQVSNLPTERTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDINYFPGYAKMPGYETVLTDFFWEMVHKDGVGNQQEEKGANHVVVK"	"reviewed"	"{'taxId': '4577', 'scientificName': 'Zea mays', 'fullName': 'Zea mays (Maize)'}"