GET /api/protein/UniProt/Q82XF2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q82XF2",
"id": "FETP_NITEU",
"source_organism": {
"taxId": "228410",
"scientificName": "Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)",
"fullName": "Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)"
},
"name": "Probable Fe(2+)-trafficking protein",
"description": [
"Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes"
],
"length": 90,
"sequence": "MVRSVKCIRLGCEAEGLDFPPYPGELGKRIFDNVSKEAWSQWIKHQTMLVNEMRLNLADIKARKYLASQMEAYFFGEGADQPAGYIPPDK",
"proteome": "UP000001416",
"gene": "NE0322",
"go_terms": [
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "51808328592b1594bd8626339f67b5c5c996efd8",
"counters": {
"domain_architectures": 6180,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6180
}
}
}