"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q82XF2"	"{'domain_architectures': 6180, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6180}"	"['Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes']"	"NE0322"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"FETP_NITEU"	"51808328592b1594bd8626339f67b5c5c996efd8"	True	False	False	90	"Probable Fe(2+)-trafficking protein"	3	"UP000001416"	"MVRSVKCIRLGCEAEGLDFPPYPGELGKRIFDNVSKEAWSQWIKHQTMLVNEMRLNLADIKARKYLASQMEAYFFGEGADQPAGYIPPDK"	"reviewed"	"{'taxId': '228410', 'scientificName': 'Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)', 'fullName': 'Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)'}"