General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q801N6",
        "id": "M4GDB_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "MIF4G domain-containing protein B",
        "description": [
            "Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation (By similarity)"
        ],
        "length": 223,
        "sequence": "MADSEEQEDYKIQGFDADIQNLLKTALKEPGSVDLEKAANVIVDQSLRDSTFSREAGRMCYTIIQVESKQTGCTMFRSSLLNRLQVEYRNRKETRARSLQEWVCYVGFMCNVFDYLRVNNMPMLALVNPVYDCLFDLVQPDSLKKEVEVDCLVLQLHRVGEQLEKMNCQRMDELFSQLRDGFLLQGGLSSLTQLLLLEMIEYRAAGWSMTDAAQKYYYSEVSD",
        "proteome": "UP000186698",
        "gene": "mif4gd-b",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "634aac523f4a9a7676bc8efd40f07a3e41d6a0e3",
        "counters": {
            "domain_architectures": 9186,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9186
        }
    }
}