"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q801N6"	"{'domain_architectures': 9186, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9186}"	"['Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation (By similarity)']"	"mif4gd-b"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M4GDB_XENLA"	"634aac523f4a9a7676bc8efd40f07a3e41d6a0e3"	True	False	False	223	"MIF4G domain-containing protein B"	2	"UP000186698"	"MADSEEQEDYKIQGFDADIQNLLKTALKEPGSVDLEKAANVIVDQSLRDSTFSREAGRMCYTIIQVESKQTGCTMFRSSLLNRLQVEYRNRKETRARSLQEWVCYVGFMCNVFDYLRVNNMPMLALVNPVYDCLFDLVQPDSLKKEVEVDCLVLQLHRVGEQLEKMNCQRMDELFSQLRDGFLLQGGLSSLTQLLLLEMIEYRAAGWSMTDAAQKYYYSEVSD"	"reviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"