GET /api/protein/UniProt/Q7WFD3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7WFD3",
        "id": "NRDR_BORBR",
        "source_organism": {
            "taxId": "257310",
            "scientificName": "Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)",
            "fullName": "Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)"
        },
        "name": "Transcriptional repressor NrdR",
        "description": [
            "Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR-boxes"
        ],
        "length": 160,
        "sequence": "MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTEYDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASGMREVPSEQIGELVMGELKRLDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD",
        "proteome": null,
        "gene": "nrdR",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045892",
                "name": "negative regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af57b84d7809b9ad3c7463ad27822f3b0692d0c2",
        "counters": {
            "domain_architectures": 19095,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19095
        }
    }
}