GET /api/protein/UniProt/Q7WFD3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7WFD3",
"id": "NRDR_BORBR",
"source_organism": {
"taxId": "257310",
"scientificName": "Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)",
"fullName": "Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)"
},
"name": "Transcriptional repressor NrdR",
"description": [
"Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR-boxes"
],
"length": 160,
"sequence": "MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTEYDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASGMREVPSEQIGELVMGELKRLDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD",
"proteome": null,
"gene": "nrdR",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045892",
"name": "negative regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "af57b84d7809b9ad3c7463ad27822f3b0692d0c2",
"counters": {
"domain_architectures": 19095,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"profile": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19095
}
}
}