"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7WFD3"	"{'domain_architectures': 19095, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'profile': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 19095}"	"['Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR-boxes']"	"nrdR"	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0045892', 'name': 'negative regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"NRDR_BORBR"	"af57b84d7809b9ad3c7463ad27822f3b0692d0c2"	True	False	False	160	"Transcriptional repressor NrdR"	3	""	"MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTEYDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASGMREVPSEQIGELVMGELKRLDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD"	"reviewed"	"{'taxId': '257310', 'scientificName': 'Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)', 'fullName': 'Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)'}"