GET /api/protein/UniProt/Q7W0T2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7W0T2",
"id": "Q7W0T2_BORPA",
"source_organism": {
"taxId": "257311",
"scientificName": "Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)",
"fullName": "Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)"
},
"name": "Ribonuclease H",
"description": [
"Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
],
"length": 155,
"sequence": "MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGVEAARGR",
"proteome": null,
"gene": "rnhA",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004523",
"name": "RNA-DNA hybrid ribonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "224027d936c6c9b21601491f9e6d744fa9b08176",
"counters": {
"domain_architectures": 38121,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38121
}
}
}