"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7W0T2"	"{'domain_architectures': 38121, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 38121}"	"['Endonuclease that specifically degrades the RNA of RNA-DNA hybrids']"	"rnhA"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004523', 'name': 'RNA-DNA hybrid ribonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q7W0T2_BORPA"	"224027d936c6c9b21601491f9e6d744fa9b08176"	True	False	False	155	"Ribonuclease H"	3	""	"MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGVEAARGR"	"unreviewed"	"{'taxId': '257311', 'scientificName': 'Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)', 'fullName': 'Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)'}"
