HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7UZV0",
"id": "RL2_PROMP",
"source_organism": {
"taxId": "59919",
"scientificName": "Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)",
"fullName": "Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)"
},
"name": "Large ribosomal subunit protein uL2",
"description": [
"One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome"
],
"length": 287,
"sequence": "MAIRKFKPYTPGTRQRVVTDFSEITGSKPERSLIVSKHRNKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKKNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGIKVGQNVISGEGVPIEEGNAMPLSSMPLGSNVHCVELYAGRGAQMVRSAGASAQLMAKEGEYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKAALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS",
"proteome": null,
"gene": "rplB",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5a5236f1178b35da4ef721902b44a3e094cfbe90",
"counters": {
"domain_architectures": 49929,
"entries": 23,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 2,
"pfam": 2,
"smart": 2,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 49929
}
}
}