"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7UZV0"	"{'domain_architectures': 27309, 'entries': 23, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 2, 'pfam': 2, 'smart': 2, 'hamap': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'interpro': 9}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27309}"	"['Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell', 'One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation']"	"rplB"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016740', 'name': 'transferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015934', 'name': 'large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL2_PROMP"	"5a5236f1178b35da4ef721902b44a3e094cfbe90"	True	False	287	"Large ribosomal subunit protein uL2"	3	"UP000001026"	"MAIRKFKPYTPGTRQRVVTDFSEITGSKPERSLIVSKHRNKGRNNRGVITCRHRGGGHKRQYRLVDFRRDKKNINAKVAAIHYDPHRNARLALLFYEDGEKRYIIAPAGIKVGQNVISGEGVPIEEGNAMPLSSMPLGSNVHCVELYAGRGAQMVRSAGASAQLMAKEGEYVALKLPSTEVRLVRKECYATLGEVGNSEIRNTSLGKAGRRRWLGRRPQVRGSVMNPCDHPHGGGEGKAPIGRAGPVTPWGKAALGLKTRKKNKPSNKLVVRRRRRISKRSRGGRDS"	"reviewed"	"{'taxId': '59919', 'scientificName': 'Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)', 'fullName': 'Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)'}"
