General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7SHI8",
        "id": "LP9C_NEUCR",
        "source_organism": {
            "taxId": "367110",
            "scientificName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)",
            "fullName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)"
        },
        "name": "AA9 family lytic polysaccharide monooxygenase C",
        "description": [
            "Lytic polysaccharide monooxygenase (LPMO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C4 oxidation products (PubMed:23102010, PubMed:24324265, PubMed:24733907, PubMed:26178376, PubMed:30238672, PubMed:31835532, PubMed:35080911, PubMed:36271009). Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate (PubMed:36271009). Degrades various hemicelluloses, in particular xyloglucan (PubMed:24733907, PubMed:31835532). Active on tamarind xyloglucan and konjac glucomannan (PubMed:26178376). Acts on the glucose backbone of xyloglucan, accepting various substitutions (xylose, galactose) in almost allpositions (PubMed:24733907). In contrast to all previously characterized LPMOs, which are active only on polysaccharides, is able to cleave soluble cello-oligosaccharides as short as a tetramer (PubMed:24324265). The cello-oligosaccharide products released by this enzyme contain a C4 gemdiol/keto group at the non-reducing end (PubMed:24324265). Binds to the inner wood cell wall layer and consumes enzymatically generated H(2)O(2) (PubMed:36271009)"
        ],
        "length": 359,
        "sequence": "MKTGSILAALVASASAHTIFQKVSVNGADQGQLKGIRAPANNNPVTDVMSSDIICNAVTMKDSNVLTVPAGAKVGHFWGHEIGGAAGPNDADNPIAASHKGPIMVYLAKVDNAATTGTSGLKWFKVAEAGLSNGKWAVDDLIANNGWSYFDMPTCIAPGQYLMRAELIALHNAGSQAGAQFYIGCAQINVTGGGSASPSNTVSFPGAYSASDPGILINIYGGSGKTDNGGKPYQIPGPALFTCPAGGSGGSSPAPATTASTPKPTSASAPKPVSTTASTPKPTNGSGSGTGAAHSTKCGGSKPAATTKASNPQPTNGGNSAVRAAALYGQCGGKGWTGPTSCASGTCKFSNDWYSQCLP",
        "proteome": "UP000001805",
        "gene": "gh61-3",
        "go_terms": [
            {
                "identifier": "GO:0030248",
                "name": "cellulose binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0ee351bc19c4eac8c2647414ef821eabcc14df1e",
        "counters": {
            "domain_architectures": 2831,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2831
        }
    }
}