HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7SHI8",
"id": "LP9C_NEUCR",
"source_organism": {
"taxId": "367110",
"scientificName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)",
"fullName": "Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)"
},
"name": "AA9 family lytic polysaccharide monooxygenase C",
"description": [
"Lytic polysaccharide monooxygenase (LPMO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C4 oxidation products (PubMed:23102010, PubMed:24324265, PubMed:24733907, PubMed:26178376, PubMed:30238672, PubMed:31835532, PubMed:35080911, PubMed:36271009). Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate (PubMed:36271009). Degrades various hemicelluloses, in particular xyloglucan (PubMed:24733907, PubMed:31835532). Active on tamarind xyloglucan and konjac glucomannan (PubMed:26178376). Acts on the glucose backbone of xyloglucan, accepting various substitutions (xylose, galactose) in almost allpositions (PubMed:24733907). In contrast to all previously characterized LPMOs, which are active only on polysaccharides, is able to cleave soluble cello-oligosaccharides as short as a tetramer (PubMed:24324265). The cello-oligosaccharide products released by this enzyme contain a C4 gemdiol/keto group at the non-reducing end (PubMed:24324265). Binds to the inner wood cell wall layer and consumes enzymatically generated H(2)O(2) (PubMed:36271009)"
],
"length": 359,
"sequence": "MKTGSILAALVASASAHTIFQKVSVNGADQGQLKGIRAPANNNPVTDVMSSDIICNAVTMKDSNVLTVPAGAKVGHFWGHEIGGAAGPNDADNPIAASHKGPIMVYLAKVDNAATTGTSGLKWFKVAEAGLSNGKWAVDDLIANNGWSYFDMPTCIAPGQYLMRAELIALHNAGSQAGAQFYIGCAQINVTGGGSASPSNTVSFPGAYSASDPGILINIYGGSGKTDNGGKPYQIPGPALFTCPAGGSGGSSPAPATTASTPKPTSASAPKPVSTTASTPKPTNGSGSGTGAAHSTKCGGSKPAATTKASNPQPTNGGNSAVRAAALYGQCGGKGWTGPTSCASGTCKFSNDWYSQCLP",
"proteome": "UP000001805",
"gene": "gh61-3",
"go_terms": [
{
"identifier": "GO:0030248",
"name": "cellulose binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0ee351bc19c4eac8c2647414ef821eabcc14df1e",
"counters": {
"domain_architectures": 2831,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 2,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2831
}
}
}