"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7SHI8"	"{'domain_architectures': 2831, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 2, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'profile': 1, 'smart': 1, 'ssf': 1, 'pfam': 2, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2831}"	"['Lytic polysaccharide monooxygenase (LPMO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C4 oxidation products (PubMed:23102010, PubMed:24324265, PubMed:24733907, PubMed:26178376, PubMed:30238672, PubMed:31835532, PubMed:35080911, PubMed:36271009). Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate (PubMed:36271009). Degrades various hemicelluloses, in particular xyloglucan (PubMed:24733907, PubMed:31835532). Active on tamarind xyloglucan and konjac glucomannan (PubMed:26178376). Acts on the glucose backbone of xyloglucan, accepting various substitutions (xylose, galactose) in almost allpositions (PubMed:24733907). In contrast to all previously characterized LPMOs, which are active only on polysaccharides, is able to cleave soluble cello-oligosaccharides as short as a tetramer (PubMed:24324265). The cello-oligosaccharide products released by this enzyme contain a C4 gemdiol/keto group at the non-reducing end (PubMed:24324265). Binds to the inner wood cell wall layer and consumes enzymatically generated H(2)O(2) (PubMed:36271009)']"	"gh61-3"	"[{'identifier': 'GO:0030248', 'name': 'cellulose binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005975', 'name': 'carbohydrate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"LP9C_NEUCR"	"0ee351bc19c4eac8c2647414ef821eabcc14df1e"	True	False	False	359	"AA9 family lytic polysaccharide monooxygenase C"	1	"UP000001805"	"MKTGSILAALVASASAHTIFQKVSVNGADQGQLKGIRAPANNNPVTDVMSSDIICNAVTMKDSNVLTVPAGAKVGHFWGHEIGGAAGPNDADNPIAASHKGPIMVYLAKVDNAATTGTSGLKWFKVAEAGLSNGKWAVDDLIANNGWSYFDMPTCIAPGQYLMRAELIALHNAGSQAGAQFYIGCAQINVTGGGSASPSNTVSFPGAYSASDPGILINIYGGSGKTDNGGKPYQIPGPALFTCPAGGSGGSSPAPATTASTPKPTSASAPKPVSTTASTPKPTNGSGSGTGAAHSTKCGGSKPAATTKASNPQPTNGGNSAVRAAALYGQCGGKGWTGPTSCASGTCKFSNDWYSQCLP"	"reviewed"	"{'taxId': '367110', 'scientificName': 'Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)', 'fullName': 'Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)'}"