General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q73V87",
        "id": "MMR_MYCPA",
        "source_organism": {
            "taxId": "262316",
            "scientificName": "Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)",
            "fullName": "Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)"
        },
        "name": "Multidrug resistance protein mmr",
        "description": [
            "Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O and pyronin Y (By similarity)"
        ],
        "length": 107,
        "sequence": "MTYLFLICAILAEVVATSLLKSTQGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTALIVLIAVLFLGSPISVTKVVGVGLIIAGVVTLNLTGAH",
        "proteome": "UP000000580",
        "gene": "mmr",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6e12b6fab6ef66c4df13b2b7534ff73ca4958d16",
        "counters": {
            "domain_architectures": 39415,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39415
        }
    }
}