HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q73V87",
"id": "MMR_MYCPA",
"source_organism": {
"taxId": "262316",
"scientificName": "Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)",
"fullName": "Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)"
},
"name": "Multidrug resistance protein mmr",
"description": [
"Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O and pyronin Y (By similarity)"
],
"length": 107,
"sequence": "MTYLFLICAILAEVVATSLLKSTQGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTALIVLIAVLFLGSPISVTKVVGVGLIIAGVVTLNLTGAH",
"proteome": "UP000000580",
"gene": "mmr",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e12b6fab6ef66c4df13b2b7534ff73ca4958d16",
"counters": {
"domain_architectures": 39415,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39415
}
}
}