"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q73V87"	"{'domain_architectures': 39415, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 39415}"	"['Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O and pyronin Y (By similarity)']"	"mmr"	"[{'identifier': 'GO:0022857', 'name': 'transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005886', 'name': 'plasma membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"MMR_MYCPA"	"6e12b6fab6ef66c4df13b2b7534ff73ca4958d16"	True	False	False	107	"Multidrug resistance protein mmr"	3	"UP000000580"	"MTYLFLICAILAEVVATSLLKSTQGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTALIVLIAVLFLGSPISVTKVVGVGLIIAGVVTLNLTGAH"	"reviewed"	"{'taxId': '262316', 'scientificName': 'Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)', 'fullName': 'Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)'}"