General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q72ZK2",
        "id": "HDOX_BACC1",
        "source_organism": {
            "taxId": "222523",
            "scientificName": "Bacillus cereus (strain ATCC 10987 / NRS 248)",
            "fullName": "Bacillus cereus (strain ATCC 10987 / NRS 248)"
        },
        "name": "Heme-degrading monooxygenase",
        "description": [
            "Allows bacterial pathogens to use the host heme as an iron source. Catalyzes the oxidative degradation of the heme macrocyclic porphyrin ring to the biliverdin in the presence of a suitable electron donor such as ascorbate or NADPH--cytochrome P450 reductase, with subsequent release of free iron"
        ],
        "length": 107,
        "sequence": "MIIVTNTAKITKGNGHKLIDRFNKVGQVETMPGFLGLEVLLTQNTVDYDEVTISTRWNAKEDFQGWTKSPAFKAAHSHQGGMPDYILDNKISYYDVKVVRMPMAAAQ",
        "proteome": null,
        "gene": "isdG",
        "go_terms": [
            {
                "identifier": "GO:0004392",
                "name": "heme oxygenase (decyclizing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033212",
                "name": "iron import into cell",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "23007b841a677c251668b651301c5262100d3964",
        "counters": {
            "domain_architectures": 64685,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 64685
        }
    }
}