"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q72ZK2"	"{'domain_architectures': 64685, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 64685}"	"['Allows bacterial pathogens to use the host heme as an iron source. Catalyzes the oxidative degradation of the heme macrocyclic porphyrin ring to the biliverdin in the presence of a suitable electron donor such as ascorbate or NADPH--cytochrome P450 reductase, with subsequent release of free iron']"	"isdG"	"[{'identifier': 'GO:0004392', 'name': 'heme oxygenase (decyclizing) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0033212', 'name': 'iron import into cell', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"HDOX_BACC1"	"23007b841a677c251668b651301c5262100d3964"	True	False	False	107	"Heme-degrading monooxygenase"	3	""	"MIIVTNTAKITKGNGHKLIDRFNKVGQVETMPGFLGLEVLLTQNTVDYDEVTISTRWNAKEDFQGWTKSPAFKAAHSHQGGMPDYILDNKISYYDVKVVRMPMAAAQ"	"reviewed"	"{'taxId': '222523', 'scientificName': 'Bacillus cereus (strain ATCC 10987 / NRS 248)', 'fullName': 'Bacillus cereus (strain ATCC 10987 / NRS 248)'}"