General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6PFH3",
        "id": "DCA15_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "DDB1- and CUL4-associated factor 15",
        "description": [
            "Substrate-recognition component of the DCX(DCAF15) complex, a cullin-4-RING E3 ubiquitin-protein ligase complex that mediates ubiquitination and degradation of target proteins. The DCX(DCAF15) complex acts as a regulator of the natural killer (NK) cells effector functions, possibly by mediating ubiquitination and degradation of cohesin subunits SMC1A and SMC3. May play a role in the activation of antigen-presenting cells (APC) and their interaction with NK cells"
        ],
        "length": 600,
        "sequence": "MAPSSKSERNSGAGSAGGGPGGTGGKRAVGRRREHVLKQLERVKISGQLSPRLFRKLPPRVCVSLKNIVDEDFLYAGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIYHLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIVFGFNTRSANGMLMNMMMMSDENHRDIYISTVAVPPRGRCAACQDASRAHPGDPSAQCLRHGFMLHTKYQVVYPFPTFQPAFQLKKDQVVLLNTSYSLVACAVSVHSAGDSSFCQILYDHTALPPAPPSSPGPWSPEAAPAFPSLGVEVVPAQPSGAPEPSPAIAKAKEFVADIFRRAKEAKGSPLEETRLPSSLGPSSSRCRPSLEPQAPSGEVVPRDSPPAAETTAPEPGYINYTKLHYVLQSGEGTEPEDEFEDDKISLPFVVTDLRGRNLRPMRERTDMQGQYLTVEQLTLDFEYVINEVIRHDATWGHQFCSFSDYDIVILEVCPETNQVLINIGLLLLAFPAPTEEGQLRPKTYHTSLKVAWDLNTGIFETVSVGDLTEVKGQTSGSVWSSYRKSCVDMVMKWLVPESSGRYVNRMTNEALHKGCSLKVLADSERYTWIVL",
        "proteome": "UP000000589",
        "gene": "Dcaf15",
        "go_terms": [
            {
                "identifier": "GO:0016567",
                "name": "protein ubiquitination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9e07e9bef470d3af2910e87298803be89f195955",
        "counters": {
            "domain_architectures": 1063,
            "entries": 7,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1063
        }
    }
}