General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6P104",
        "id": "QKIB_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Protein quaking-B",
        "description": [
            "RNA reader protein, which recognizes and binds specific RNAs, thereby regulating RNA metabolic processes, such as pre-mRNA splicing, circular RNA (circRNA) formation, mRNA export, mRNA stability and/or translation (PubMed:28867488). Involved in various cellular processes, such as mRNA storage into stress granules, apoptosis, interferon response, glial cell fate and development (By similarity). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence (By similarity). Acts as a mRNA modification reader that specifically recognizes and binds mRNA transcripts modified by internal N(7)-methylguanine (m7G) (By similarity). Promotes the formation of circular RNAs (circRNAs): acts by binding to sites flanking circRNA-forming exons (By similarity). CircRNAs are produced by back-splicing circularization of pre-mRNAs (By similarity). Required to protect and promote stability of mRNAs which promotes oligodendrocyte differentiation (By similarity). Acts as an important regulator of muscle development: required during early skeletal myofibril formation by regulating the accumulation of the muscle-specific tropomyosin-3 (tpm3) transcripts (PubMed:28867488)"
        ],
        "length": 319,
        "sequence": "MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAPRIMTGPTPVMPNAALRTPAPTAPTLMPLIRQIQTSALMPTGTPHPTATLLPQTPESGIIYAPYDYPYALAPATSILEYPIDSSGVLGMAFPTKG",
        "proteome": "UP000000437",
        "gene": "qki2",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c9e8ae5a22a1dbb7a70fb9c249d4cbb76b95ca9",
        "counters": {
            "domain_architectures": 4435,
            "entries": 13,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 2,
                "smart": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4435
        }
    }
}