"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6P104"	"{'domain_architectures': 4435, 'entries': 13, 'isoforms': 2, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 2, 'smart': 1, 'cdd': 1, 'ssf': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4435}"	"[""RNA reader protein, which recognizes and binds specific RNAs, thereby regulating RNA metabolic processes, such as pre-mRNA splicing, circular RNA (circRNA) formation, mRNA export, mRNA stability and/or translation (PubMed:28867488). Involved in various cellular processes, such as mRNA storage into stress granules, apoptosis, interferon response, glial cell fate and development (By similarity). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence (By similarity). Acts as a mRNA modification reader that specifically recognizes and binds mRNA transcripts modified by internal N(7)-methylguanine (m7G) (By similarity). Promotes the formation of circular RNAs (circRNAs): acts by binding to sites flanking circRNA-forming exons (By similarity). CircRNAs are produced by back-splicing circularization of pre-mRNAs (By similarity). Required to protect and promote stability of mRNAs which promotes oligodendrocyte differentiation (By similarity). Acts as an important regulator of muscle development: required during early skeletal myofibril formation by regulating the accumulation of the muscle-specific tropomyosin-3 (tpm3) transcripts (PubMed:28867488)""]"	"qki2"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"QKIB_DANRE"	"9c9e8ae5a22a1dbb7a70fb9c249d4cbb76b95ca9"	True	False	False	319	"Protein quaking-B"	2	"UP000000437"	"MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAPRIMTGPTPVMPNAALRTPAPTAPTLMPLIRQIQTSALMPTGTPHPTATLLPQTPESGIIYAPYDYPYALAPATSILEYPIDSSGVLGMAFPTKG"	"reviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"