GET /api/protein/UniProt/Q6MQW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6MQW6",
        "id": "Q6MQW6_BDEBA",
        "source_organism": {
            "taxId": "264462",
            "scientificName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)",
            "fullName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)"
        },
        "name": "Peptidyl-prolyl cis-trans isomerase",
        "description": [
            "Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity"
        ],
        "length": 157,
        "sequence": "MKRVLAFNYVLKGPDGNVLDASERNQPLPFLEGAGQIIPKLEEEIKDLQEGDKKTVKLAAKDAYGEVKDNMFMDVPKAELAHLPQLEVGAHLRLELGQGAHIVRVTKITDEAVTLDGNHPLAGQDLEFAIEMVLIREATAEEVLHGHPHGLHGNSGH",
        "proteome": "UP000008080",
        "gene": "slyD",
        "go_terms": [
            {
                "identifier": "GO:0003755",
                "name": "peptidyl-prolyl cis-trans isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "597ff609af148c6a7b237ac50dda1c5478f47b0c",
        "counters": {
            "domain_architectures": 62513,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 62513
        }
    }
}