"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6MQW6"	"{'domain_architectures': 49865, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 49865}"	"['Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity']"	"slyD"	"[{'identifier': 'GO:0003755', 'name': 'peptidyl-prolyl cis-trans isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q6MQW6_BDEBA"	"597ff609af148c6a7b237ac50dda1c5478f47b0c"	True	False	157	"Peptidyl-prolyl cis-trans isomerase"	3	"UP000008080"	"MKRVLAFNYVLKGPDGNVLDASERNQPLPFLEGAGQIIPKLEEEIKDLQEGDKKTVKLAAKDAYGEVKDNMFMDVPKAELAHLPQLEVGAHLRLELGQGAHIVRVTKITDEAVTLDGNHPLAGQDLEFAIEMVLIREATAEEVLHGHPHGLHGNSGH"	"unreviewed"	"{'taxId': '264462', 'scientificName': 'Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)', 'fullName': 'Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)'}"