GET /api/protein/UniProt/Q6IRB1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6IRB1",
        "id": "ARC2B_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Actin-related protein 2/3 complex subunit 2-B",
        "description": [
            "Actin-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility (By similarity). In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA (Probable). The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs) (By similarity)"
        ],
        "length": 300,
        "sequence": "MILLEVNNRIIEEILTLKFENAAAGNKPEVVEVTFADFDGVLYHVSNPNGDKAKVMISISLKFYKELQEHGADEVLKNVYGNFLVAPESGYNVSLLYDLEALPSNKDSVIHQAGMLKRNCFASVFEKYFKFQEEGKEGEKRAVIHYREDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTSANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFAAR",
        "proteome": "UP000186698",
        "gene": "arpc2-b",
        "go_terms": [
            {
                "identifier": "GO:0030041",
                "name": "actin filament polymerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034314",
                "name": "Arp2/3 complex-mediated actin nucleation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005885",
                "name": "Arp2/3 protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015629",
                "name": "actin cytoskeleton",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c0a01558734d1c30b00ab465be0e4c1c675f7bf",
        "counters": {
            "domain_architectures": 5195,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5195
        }
    }
}