"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6IRB1"	"{'domain_architectures': 5195, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5195}"	"['Actin-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility (By similarity). In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA (Probable). The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs) (By similarity)']"	"arpc2-b"	"[{'identifier': 'GO:0030041', 'name': 'actin filament polymerization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0034314', 'name': 'Arp2/3 complex-mediated actin nucleation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005885', 'name': 'Arp2/3 protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015629', 'name': 'actin cytoskeleton', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ARC2B_XENLA"	"3c0a01558734d1c30b00ab465be0e4c1c675f7bf"	True	False	False	300	"Actin-related protein 2/3 complex subunit 2-B"	1	"UP000186698"	"MILLEVNNRIIEEILTLKFENAAAGNKPEVVEVTFADFDGVLYHVSNPNGDKAKVMISISLKFYKELQEHGADEVLKNVYGNFLVAPESGYNVSLLYDLEALPSNKDSVIHQAGMLKRNCFASVFEKYFKFQEEGKEGEKRAVIHYREDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTSANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFAAR"	"reviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"