General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6DRM0",
        "id": "GET1_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Guided entry of tail-anchored proteins factor 1",
        "description": [
            "Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER) (By similarity). Together with CAMLG/GET2, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity). Required to ensure correct topology and ER insertion of CAMLG (By similarity)"
        ],
        "length": 170,
        "sequence": "MAAGFNWFLVLSSVFLCNLVKTFLPSISSFLSKIFHKDADQEMEMRTEIQNMKMELSTISMMDEFARYARLERKINKMTDQLKTLVKSRTAQQAKMKWIVNIAFYILQAALMISLILKYYADPVTVVPSKWIAPLERLVAFPSGVAGGVGITCWLVVCNKVVALILQAVS",
        "proteome": "UP000000437",
        "gene": "get1",
        "go_terms": [
            {
                "identifier": "GO:0071816",
                "name": "tail-anchored membrane protein insertion into ER membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9f2e7cc5ea3a76e3252a4f0e5ad879a872ac0cf4",
        "counters": {
            "domain_architectures": 3869,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3869
        }
    }
}