"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6DRM0"	"{'domain_architectures': 3869, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3869}"	"['Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER) (By similarity). Together with CAMLG/GET2, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity). Required to ensure correct topology and ER insertion of CAMLG (By similarity)']"	"get1"	"[{'identifier': 'GO:0071816', 'name': 'tail-anchored membrane protein insertion into ER membrane', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"GET1_DANRE"	"9f2e7cc5ea3a76e3252a4f0e5ad879a872ac0cf4"	True	False	False	170	"Guided entry of tail-anchored proteins factor 1"	2	"UP000000437"	"MAAGFNWFLVLSSVFLCNLVKTFLPSISSFLSKIFHKDADQEMEMRTEIQNMKMELSTISMMDEFARYARLERKINKMTDQLKTLVKSRTAQQAKMKWIVNIAFYILQAALMISLILKYYADPVTVVPSKWIAPLERLVAFPSGVAGGVGITCWLVVCNKVVALILQAVS"	"reviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"