GET /api/protein/UniProt/Q6BH67/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6BH67",
"id": "Q6BH67_DEBHA",
"source_organism": {
"taxId": "284592",
"scientificName": "Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)",
"fullName": "Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast)"
},
"name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3",
"description": [
"Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity"
],
"length": 340,
"sequence": "MKVSIVQLYVTFVSLFGLVMAALTNEEMTKYVKSQGNKVVSLNDENYEHILNGERDYHLIVMLSSQSPKINCVLCNEFKPDFETIGNSWIQDHPNGLSKEALEDTESVIPKKNVYFMFSEFTESRNFFSSLQLNNIPKVFHFPPSTNKRPNEYVNQFDEYQFYQGDHKVLLTSWLNQITGHTFNIYIPPDYTRIATNALITFVVVMLIRKFNAEFIMVATSRILWSGISLVAILLLISGYMFNQIRGVPFVMEHQGGKVDYFIPQQQNQLGVETQIMSFVYGCLSLLVVMLIKRAPQIKNSHVKLIAVIVLSILIFVLYSVLLSIFGIKGMGYPYRFITL",
"proteome": "UP000000599",
"gene": "DEHA2G20966g",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "01e4bee5f52643cdc435478c60cc0704ffb519b7",
"counters": {
"domain_architectures": 8278,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8278
}
}
}