"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6BH67"	"{'domain_architectures': 8278, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 8278}"	"['Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity']"	"DEHA2G20966g"	""	"Q6BH67_DEBHA"	"01e4bee5f52643cdc435478c60cc0704ffb519b7"	True	False	False	340	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3"	3	"UP000000599"	"MKVSIVQLYVTFVSLFGLVMAALTNEEMTKYVKSQGNKVVSLNDENYEHILNGERDYHLIVMLSSQSPKINCVLCNEFKPDFETIGNSWIQDHPNGLSKEALEDTESVIPKKNVYFMFSEFTESRNFFSSLQLNNIPKVFHFPPSTNKRPNEYVNQFDEYQFYQGDHKVLLTSWLNQITGHTFNIYIPPDYTRIATNALITFVVVMLIRKFNAEFIMVATSRILWSGISLVAILLLISGYMFNQIRGVPFVMEHQGGKVDYFIPQQQNQLGVETQIMSFVYGCLSLLVVMLIKRAPQIKNSHVKLIAVIVLSILIFVLYSVLLSIFGIKGMGYPYRFITL"	"unreviewed"	"{'taxId': '284592', 'scientificName': 'Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)', 'fullName': 'Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast)'}"