General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5ZHU0",
        "id": "HRG1_CHICK",
        "source_organism": {
            "taxId": "9031",
            "scientificName": "Gallus gallus",
            "fullName": "Gallus gallus (Chicken)"
        },
        "name": "Heme transporter HRG1",
        "description": [
            "Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment. In macrophages of the reticuloendothelial system, is the heme transporter for heme-iron recycling. Essential for macrophage iron homeostasis, transports heme from the phagolysosome to the cytoplasm during erythrophagocytosis (EP)"
        ],
        "length": 147,
        "sequence": "MAVSRALALRLAYAAAGALMGFSAFFTWSLAPAFRQPATAAAGGLSGVLALWALITHVMYVQDYWRTWLKGLRFFLFIGILFSALSVVGFCTFLVLAITQHQSLTDPRSYYLSCVWSFISLKWAFLLSLYAYRYRNEFADISILSDF",
        "proteome": "UP000000539",
        "gene": "SLC48A1",
        "go_terms": [
            {
                "identifier": "GO:0015232",
                "name": "heme transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015886",
                "name": "heme transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbbc6e1f0ac88ec8995aa5e3867e256ce5396d39",
        "counters": {
            "domain_architectures": 586,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 586
        }
    }
}