"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5ZHU0"	"{'domain_architectures': 570, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'prints': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 570}"	"['Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment. In macrophages of the reticuloendothelial system, is the heme transporter for heme-iron recycling. Essential for macrophage iron homeostasis, transports heme from the phagolysosome to the cytoplasm during erythrophagocytosis (EP)']"	"SLC48A1"	"[{'identifier': 'GO:0015232', 'name': 'heme transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015886', 'name': 'heme transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"HRG1_CHICK"	"cbbc6e1f0ac88ec8995aa5e3867e256ce5396d39"	True	False	147	"Heme transporter HRG1"	2	"UP000000539"	"MAVSRALALRLAYAAAGALMGFSAFFTWSLAPAFRQPATAAAGGLSGVLALWALITHVMYVQDYWRTWLKGLRFFLFIGILFSALSVVGFCTFLVLAITQHQSLTDPRSYYLSCVWSFISLKWAFLLSLYAYRYRNEFADISILSDF"	"reviewed"	"{'taxId': '9031', 'scientificName': 'Gallus gallus', 'fullName': 'Gallus gallus (Chicken)'}"