GET /api/protein/UniProt/Q5SLR3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5SLR3",
"id": "ODBB_THET8",
"source_organism": {
"taxId": "300852",
"scientificName": "Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)",
"fullName": "Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)"
},
"name": "2-oxoisovalerate dehydrogenase subunit beta",
"description": [
"Component of the branched-chain alpha-keto dehydrogenase complex, which catalyzes the overall conversion of alpha-keto acids derived from the branched-chain amino-acids valine, leucine and isoleucine to acyl-CoA and CO(2) (Probable). The complex contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (Probable). The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate (Probable)"
],
"length": 324,
"sequence": "MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKEEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY",
"proteome": "UP000000532",
"gene": "TTHA0230",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4347a88d8b8d5a4cc8b0ce107fb03375ff211f8d",
"counters": {
"domain_architectures": 52316,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 4,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"smart": 1,
"ssf": 2,
"cdd": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 52316
}
}
}