"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5SLR3"	"{'domain_architectures': 52316, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 4, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'smart': 1, 'ssf': 2, 'cdd': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 52316}"	"['Component of the branched-chain alpha-keto dehydrogenase complex, which catalyzes the overall conversion of alpha-keto acids derived from the branched-chain amino-acids valine, leucine and isoleucine to acyl-CoA and CO(2) (Probable). The complex contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (Probable). The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate (Probable)']"	"TTHA0230"	""	"ODBB_THET8"	"4347a88d8b8d5a4cc8b0ce107fb03375ff211f8d"	True	False	False	324	"2-oxoisovalerate dehydrogenase subunit beta"	1	"UP000000532"	"MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKEEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY"	"reviewed"	"{'taxId': '300852', 'scientificName': 'Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)', 'fullName': 'Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)'}"