GET /api/protein/UniProt/Q5M7N2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "Q5M7N2",
"id": "Q5M7N2_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Dual specificity protein phosphatase 23",
"description": [
"Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14)"
],
"length": 132,
"sequence": "MAMPRLPAHYEYLCENGIRHLITLTEHKPPYHDTCPGITLHRIRILDFCAPSLEQIKNFLKIVDDAKAKGEAVGVHCLHGFGRTGTMLACYLVKVWKITGVDAINEIRSLRRGSIETTEQEKAIIQFHHHIK",
"proteome": "UP000008143",
"gene": "dusp23",
"go_terms": [
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9ac91344c7a6273f0953acb6de9866e6d04df133",
"counters": {
"domain_architectures": 5421,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"profile": 2,
"smart": 2,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5421
}
}
}